Protein Info for BWI76_RS11310 in Klebsiella michiganensis M5al

Annotation: lysogenization protein HflD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04356: DUF489" amino acids 7 to 199 (193 residues), 245.9 bits, see alignment E=1.7e-77

Best Hits

Swiss-Prot: 97% identical to HFLD_KLEP7: High frequency lysogenization protein HflD homolog (hflD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_16570)

Predicted SEED Role

"FIG002903: a protein of unknown function perhaps involved in purine metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2L7 at UniProt or InterPro

Protein Sequence (213 amino acids)

>BWI76_RS11310 lysogenization protein HflD (Klebsiella michiganensis M5al)
MAKNYYDITLALAGVCQAARLVQELAHQGHCDSDALHVSLNSIIDLDPDSTLAVFGGSEA
NLRLGLETLIGVLNTSSRQGLNAELTRYTLSLMVLERKLAASKGAMDTLGNRIGGLRRQL
EHFDLQSETLLSAMAGIYVDVISPLGPRIQVTGSPAVLQSPQVQAKVRSALLAGIRSAVL
WHQVGGGRLQLMFSRHRLVNQAKQILAHLTPEL