Protein Info for BWI76_RS11230 in Klebsiella michiganensis M5al

Annotation: NAD-dependent deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 49 to 222 (174 residues), 175.9 bits, E=4e-56

Best Hits

Swiss-Prot: 85% identical to NPD_ECO57: NAD-dependent protein deacylase (cobB) from Escherichia coli O157:H7

KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 92% identity to kpn:KPN_01117)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Sequence Analysis Tools

See A0A285B2D4 at UniProt or InterPro

Protein Sequence (281 amino acids)

>BWI76_RS11230 NAD-dependent deacylase (Klebsiella michiganensis M5al)
MQSRRLHRLSRFRRNKRRLRDRLRQRIFFGEDKETPETMEKPRVVVLTGAGISAESGIKT
FRAADGLWEEHRVEDVATPEGFARDPALVQAFYNDRRRQLQSPDIAPNAAHQALARLEEA
LGDHFLLVTQNIDNLHERAGNRRIIHMHGELLKVRCSWSGQVLEWTGDVTTEDKCHCCQF
PAPLRPHVVWFGEMPLDMDEIYLALAECDIFIAIGTSGHVYPAAGFVHEARLQGAHTVEL
NLEPSQVGSEFAEKHYGLASEEVPRFVEKLLHEVARSTPRL