Protein Info for BWI76_RS11210 in Klebsiella michiganensis M5al

Annotation: outer membrane-specific lipoprotein transporter subunit LolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 313 to 339 (27 residues), see Phobius details amino acids 346 to 363 (18 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 8 to 402 (395 residues), 483.6 bits, see alignment E=2.5e-149 PF12704: MacB_PCD" amino acids 30 to 215 (186 residues), 53.9 bits, see alignment E=3e-18 PF02687: FtsX" amino acids 273 to 395 (123 residues), 65.1 bits, see alignment E=6.3e-22

Best Hits

Swiss-Prot: 91% identical to LOLC_ECOL6: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 96% identity to kpe:KPK_3440)

MetaCyc: 91% identical to lipoprotein release complex - inner membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B269 at UniProt or InterPro

Protein Sequence (402 amino acids)

>BWI76_RS11210 outer membrane-specific lipoprotein transporter subunit LolC (Klebsiella michiganensis M5al)
MDDMYQPAALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQN
NILGLMPQAILSAKQGSINPQQLPESAARLQGVTRVAPLTTGDVVLQSARSVAVGVMLGI
DPAQKDPLTPYLVNVKQSDLQAGKYNVILGEQLAGQLGVNRGDQIRVMVPSASQFTPMGR
VPSQRLFNVIGTFAANSEVDGYQMLTNIDDASRLMRYPQGNITGWRLWLNQPLQVDTLSQ
QTLPEGTKWQDWRERKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGMMVMEKQGEV
AILQTLGLTPRQIMLVFMVQGASAGIVGALLGAGLGALLASQLNNLMPIIGAFLDGAALP
VAIEPLQVIVIALVAMALALLSTLYPSWRAAATQPAEALRYE