Protein Info for BWI76_RS11195 in Klebsiella michiganensis M5al

Annotation: multiple stress resistance protein BhsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07338: YdgH_BhsA-like" amino acids 34 to 85 (52 residues), 70.7 bits, see alignment E=4e-24

Best Hits

Swiss-Prot: 85% identical to BHSA_ECOLI: Multiple stress resistance protein BhsA (bhsA) from Escherichia coli (strain K12)

KEGG orthology group: K12151, multiple stress resistance protein BhsA (inferred from 93% identity to kpn:KPN_01110)

Predicted SEED Role

"Putative outer membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B263 at UniProt or InterPro

Protein Sequence (85 amino acids)

>BWI76_RS11195 multiple stress resistance protein BhsA (Klebsiella michiganensis M5al)
MKNVKTLAIAAVLSSLSFASFAAVEVQSTPAGQHKIGTVSASAGTNLGSLEDQLAQKAEE
MGATSYRITSVTGPNTLHGTAVIYK