Protein Info for BWI76_RS11080 in Klebsiella michiganensis M5al

Annotation: ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 1 to 317 (317 residues), 485.1 bits, see alignment E=4.4e-150 PF00108: Thiolase_N" amino acids 36 to 142 (107 residues), 28.3 bits, see alignment E=1.7e-10 PF08545: ACP_syn_III" amino acids 106 to 183 (78 residues), 100.8 bits, see alignment E=5e-33 PF08541: ACP_syn_III_C" amino acids 228 to 316 (89 residues), 124.1 bits, see alignment E=3.2e-40

Best Hits

Swiss-Prot: 96% identical to FABH_KLEP7: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 95% identity to kpe:KPK_3467)

MetaCyc: 90% identical to 3-oxoacyl-[acyl carrier protein] synthase 3 (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-acetyltransferase. [EC: 2.3.1.38]; Beta-ketoacyl-acyl-carrier-protein synthase III. [EC: 2.3.1.38, 2.3.1.180]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B247 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BWI76_RS11080 ketoacyl-ACP synthase III (Klebsiella michiganensis M5al)
MYTKIIGTGSYLPEHVRTNAELENMVDTSDEWIVTRTGIRERRIAAPNETVATMGLEAAK
NALDMAGVKPEQIGLIIVATTSGTHAFPSSACQIQSMLGIKGCPAFDVAAACAGFTYALS
VADQYVKNGAVDYALVIGADVLARTCDPADRGTIIIFGDGAGAVVLGASEEPGIISTHLH
ADGSYGELLTLPNADRVEPENPIYLTMAGNEVFKVAVTELAHIVDETLAANNLERSALDW
LVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIQRGQLIL
LEAFGGGFTWGSALVRF