Protein Info for BWI76_RS11075 in Klebsiella michiganensis M5al
Annotation: phosphate acyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 93% identical to PLSX_KLEP7: Phosphate acyltransferase (plsX) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 92% identity to kva:Kvar_3292)Predicted SEED Role
"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria
MetaCyc Pathways
- superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
- phosphatidylglycerol biosynthesis I (6/6 steps found)
- phosphatidylglycerol biosynthesis II (6/6 steps found)
- CDP-diacylglycerol biosynthesis I (4/4 steps found)
- CDP-diacylglycerol biosynthesis II (4/4 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
- oleate biosynthesis III (cyanobacteria) (2/3 steps found)
- phosphatidate biosynthesis (yeast) (3/5 steps found)
- diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
- palmitoyl ethanolamide biosynthesis (2/6 steps found)
- superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
- stigma estolide biosynthesis (2/7 steps found)
- anandamide biosynthesis II (2/8 steps found)
- anandamide biosynthesis I (3/12 steps found)
- superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.15
Use Curated BLAST to search for 2.3.1.15
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B299 at UniProt or InterPro
Protein Sequence (365 amino acids)
>BWI76_RS11075 phosphate acyltransferase (Klebsiella michiganensis M5al) MTRLTLALDVMGGDFGPSVTVPAALQALNSNSQLTLLLVGDPDAIAPLLAKADFEQRSRL QVIPAQSVIASDARPAQAIRASRGSSMRIALELVKEGRAQACVSAGNTGALMGLAKLLLK PIEGIERPALVTMLPHQLKGKTVVLDLGANVDCDSTMLVQFAVMGAVLAEEVIGIKDPRV ALLNIGEEEMKGLSSIRDAAAVLKTLPTLNYIGYLEANELLTGKTDVLVCDGFTGNVTLK TMEGVVRMFLSLLKSQGEGKKRSWWLLLLKRWLQKSLSRRFSHLNPDQYNGACLLGLRGS VIKSHGAANQRAFCVAIEQAVQAVQRQVPQRIAARLESLYPAGFELPEGGRSGSSRPQTR MTGND