Protein Info for BWI76_RS11070 in Klebsiella michiganensis M5al

Annotation: 50S ribosomal protein L32

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 57 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF01783: Ribosomal_L32p" amino acids 2 to 57 (56 residues), 72.2 bits, see alignment E=1.6e-24 TIGR01031: ribosomal protein bL32" amino acids 2 to 55 (54 residues), 63.1 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 98% identical to RL32_KLEP7: 50S ribosomal protein L32 (rpmF) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02911, large subunit ribosomal protein L32 (inferred from 96% identity to eco:b1089)

MetaCyc: 96% identical to 50S ribosomal subunit protein L32 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B282 at UniProt or InterPro

Protein Sequence (57 amino acids)

>BWI76_RS11070 50S ribosomal protein L32 (Klebsiella michiganensis M5al)
MAVQQNKPTRSKRGMRRSHDALTAVTSLSVDKASGEKHLRHHITADGFYRGRKVIAK