Protein Info for BWI76_RS11030 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 321 (304 residues), 104.6 bits, see alignment E=2.8e-34

Best Hits

KEGG orthology group: None (inferred from 90% identity to eae:EAE_16325)

Predicted SEED Role

"MFS permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B273 at UniProt or InterPro

Protein Sequence (404 amino acids)

>BWI76_RS11030 MFS transporter (Klebsiella michiganensis M5al)
MTPVPLTARAAGWVIFILALGAGFSVASIYYAQPLLPLMGANLHLSVEGMGLVPTLTQAG
YALGILFLLPLGDRHDRRKLILMKSAALAVLLLLCSLTGQLTSLLIVSLLIGMAATMAQD
IVPAAAILAPAGKQGKMVGTVMTGLLLGILLSRTVSGLVGALFGWRVMYQAAAVSIALIG
LVMWRVLPRFEIHSTLSYPQLMKSMAHLWKRYPALRRAAFAQGFLSIAFSAFWSTLAVML
LAHYQMGSAVAGGFGIAGAAGALAAPLAGGLADKFGAEKVTQMGAALVTVSFALMFLLPA
LPPHGQLILIAISAVGFDLGLQSSLVAHQNLVYGLEPQARGRLNALLFTGVFIGMSLGSV
LGSKLYVVAGWSGVVTLAVITGAIALGIRLLESARVVSAQRTVR