Protein Info for BWI76_RS11005 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 78 to 94 (17 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 231 (212 residues), 92 bits, see alignment E=1.9e-30 amino acids 211 to 392 (182 residues), 41.2 bits, see alignment E=5e-15

Best Hits

Swiss-Prot: 96% identical to MDTH_KLEP3: Multidrug resistance protein MdtH (mdtH) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_16300)

Predicted SEED Role

"MFS superfamily export protein YceL" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B292 at UniProt or InterPro

Protein Sequence (402 amino acids)

>BWI76_RS11005 MFS transporter (Klebsiella michiganensis M5al)
MSRVSQARSLGKYFLLVDNMLVVLGFFVVFPLISIRFVDQMGWAALMVGIALGLRQLVQQ
GLGIFGGAIADRFGAKPMIVTGMLMRAAGFAAMAVAHEPWVLWLSCILSGLGGTLFDPPR
AALVVKLVRPHQRGRFFSILMMQDSAGAVIGALLGSWLLQYDFRLVCSAGAALFIACAAF
NAWYLPAWKLSTVKTPVREGLGRVLRDKRFVTYVLTLTGYYMLAVQVMLMLPIMVNDIAG
SPAAVKWMYAIEATISLTLLYPIARWSEKRFRLEHRLMAGLLIMTFAMMPIGLSSNLQQL
FTLICVFYIGSIIAEPARETLGASLADARARGSYMGFSRLGLAFGGAFGYAGGGWLFDAG
KAAGQPELPWLMLGVIGLATFIALWWQFSPKRSASGMLEPRT