Protein Info for BWI76_RS10975 in Klebsiella michiganensis M5al

Annotation: N-methyltryptophan oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF01266: DAO" amino acids 4 to 350 (347 residues), 174.1 bits, see alignment E=3e-55

Best Hits

Swiss-Prot: 75% identical to MTOX_SALA4: N-methyl-L-tryptophan oxidase (solA) from Salmonella agona (strain SL483)

KEGG orthology group: None (inferred from 86% identity to eae:EAE_16275)

MetaCyc: 73% identical to N-methyl-L-tryptophan oxidase (Escherichia coli K-12 substr. MG1655)
N-methyl-L-amino-acid oxidase. [EC: 1.5.3.2]

Predicted SEED Role

"N-methyl-L-amino-acid oxidase (EC 1.5.3.2); N-methyl-L-tryptophan oxidase (EC 1.5.3.-)" (EC 1.5.3.-, EC 1.5.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.3.- or 1.5.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B280 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BWI76_RS10975 N-methyltryptophan oxidase (Klebsiella michiganensis M5al)
MQYDLIIIGSGSVGAAAGYYARQAGLNVLMIDAHQPPHQEGSHHGSTRLIRHAYGEGERY
VPLVLRAQQLWDEFAAASGEAVFERTGVINLGPADSDFLRNVASSAREFRLNIEEMDAQT
VMTRWPEIRVPDDYRAIFEPASGILRSELAVETWIRLAREAGAAQLFNCPVSAIHHQPDG
VTVETLDGEYSGKKLLISAGTWVTRLLPELPVQPIRKIFAWFQADGRYSSKNNFPAFTGE
LPNGDQFYGFPAEDNELKIGKHNGGQLISTPEERKPFGAVATDGAESFSFLRNVLPGIGG
CLHGASCTYDNTADEDFIIDTLPGHPDTLLITGLSGHGFKFAPVLGELATRFALAKPFEF
DLSPFSLARFKP