Protein Info for BWI76_RS10965 in Klebsiella michiganensis M5al

Annotation: sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF17773: UPF0176_N" amino acids 25 to 117 (93 residues), 72.8 bits, see alignment E=3.7e-24 PF00581: Rhodanese" amino acids 138 to 232 (95 residues), 60 bits, see alignment E=3.9e-20 PF12368: Rhodanese_C" amino acids 246 to 307 (62 residues), 79.3 bits, see alignment E=3.2e-26

Best Hits

Swiss-Prot: 93% identical to Y3487_KLEP3: UPF0176 protein KPK_3487 (KPK_3487) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K07146, UPF0176 protein (inferred from 94% identity to kpu:KP1_2057)

MetaCyc: 86% identical to tRNA U34 hydroxylase TrhO (Escherichia coli K-12 substr. MG1655)
RXN0-7349

Predicted SEED Role

"Rhodanese domain protein, Enterobacterial subgroup, YceA homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B262 at UniProt or InterPro

Protein Sequence (354 amino acids)

>BWI76_RS10965 sulfurtransferase (Klebsiella michiganensis M5al)
MPVLHNRISNETLKAQMLAETEPRTTISFYKYFTIIDPKATRDALWIALTKLNVFGRIYL
AHEGINAQISVPQSRVDALREFLYGFDPALNGLRLNIALDDDGKSFWVLRLKVRDRIVAD
GIDDPTFDASDVGDYLKAAEVNAMLDDPDAVFIDMRNHYEYEVGHFENALEIPADTFRDQ
LPKAVEMMQEHKDKNIVMYCTGGIRCEKASAWMKHNGFTKVSHIEGGIIEYARRAREQGL
PVRFVGKNFVFDERMGERISDDVIAHCHQCGAPCDSHTNCLNDGCHLLFIQCPSCAEKFA
GCCSEACMEEHKLPEEEQRKLRAGRENGNKIFNKSRGRLNTKLGIPDPEPSEKP