Protein Info for BWI76_RS10950 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 253 (236 residues), 125.3 bits, see alignment E=4.1e-40 amino acids 222 to 408 (187 residues), 88.1 bits, see alignment E=8.8e-29 PF12832: MFS_1_like" amino acids 22 to 349 (328 residues), 46.8 bits, see alignment E=3.5e-16 PF00083: Sugar_tr" amino acids 47 to 216 (170 residues), 31.5 bits, see alignment E=1.4e-11 amino acids 256 to 386 (131 residues), 24.9 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 94% identical to MDTG_KLEP3: Multidrug resistance protein MdtG (mdtG) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_16255)

MetaCyc: 86% identical to efflux pump MdtG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-342; TRANS-RXN0-589

Predicted SEED Role

"Multidrug-efflux transporter, major facilitator superfamily (MFS) (TC 2.A.1)" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B283 at UniProt or InterPro

Protein Sequence (416 amino acids)

>BWI76_RS10950 MFS transporter (Klebsiella michiganensis M5al)
MPSADTPINWKRNLTVTWLGCFLTGAAFSLVMPFLPLYVEQLGVTGHSALNMWSGLVFSV
TFLFSAVASPFWGGLADRKGRKIMLLRSALGMAIVMLLMGLAQNIWQFLILRALLGLLGG
FIPNANALIATQIPRHKSGWALGTLSTGAVSGALLGPLAGGFLADHWGLRTVFFMTASVL
FICFLFTLFLIRENFVAVSKKEMLSAKDVFSSLKNPKLVLSLFVTSLIIQVATGSIAPIL
TLYVRDLAGNVSDIAFISGMIASVPGIAALLSAPRLGKLGDRIGPEKILIVALVISVLLL
IPMSFVQTPLQLGILRFLLGAADGALLPAVQTLLVYNSTSQISGRIFSYNQSFRDIGNVT
GPLIGASVSANYGFRAVFLVTAGVVLFNAVYSTLTLGRSRRPQATDNTGSGTHSVN