Protein Info for BWI76_RS10905 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 29 to 46 (18 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details PF06496: DUF1097" amino acids 12 to 145 (134 residues), 129 bits, see alignment E=8.2e-42

Best Hits

Swiss-Prot: 85% identical to YCDZ_SALTY: Inner membrane protein YcdZ (ycdZ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_16210)

Predicted SEED Role

"Inner membrane protein YcdZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B286 at UniProt or InterPro

Protein Sequence (164 amino acids)

>BWI76_RS10905 hypothetical protein (Klebsiella michiganensis M5al)
MIRAMNILFAIALTTGILSGIWGWVAVALGLLSWAGFLGCTAYFACPQGGLKGLFISTCT
VMSGVVWALVIIHGSALAPQLEIVSYIMTGIVAFLMCIQARQLMLSFVPGTFIGACATFA
GSGDWRLVVPSLALGLVFGYAMKNSGLWLATRAEKNKPLANQSS