Protein Info for BWI76_RS10900 in Klebsiella michiganensis M5al

Annotation: putative oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF02613: Nitrate_red_del" amino acids 40 to 147 (108 residues), 47.8 bits, see alignment E=7.6e-17

Best Hits

Swiss-Prot: 79% identical to YCDY_ECOLI: Chaperone protein YcdY (ycdY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_16205)

Predicted SEED Role

"Putative oxidoreductase component of anaerobic dehydrogenases; Functional role page for Chaperone protein TorD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B276 at UniProt or InterPro

Protein Sequence (184 amino acids)

>BWI76_RS10900 putative oxidoreductase (Klebsiella michiganensis M5al)
MNEFSILCRVLGSLYYRQPQDPLLVPLFTLIREGKLAASWPLEQDELLERLQKSCDMQSL
AAEYNVLFVGEECRVAPYRSAWVDGATEAEVRGFLTAHGVPTGEGAADHFGSLLLAASWL
EDHAAEEESEVLETLFAEYILPWCGEFLGKVEAHATTPFWRTMAPLTREAVSAMWDELQE
ENEQ