Protein Info for BWI76_RS10890 in Klebsiella michiganensis M5al

Annotation: glyoxylate/hydroxypyruvate reductase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF02826: 2-Hacid_dh_C" amino acids 105 to 277 (173 residues), 145.9 bits, see alignment E=8.3e-47 PF03446: NAD_binding_2" amino acids 138 to 210 (73 residues), 23.5 bits, see alignment E=5.3e-09

Best Hits

Swiss-Prot: 86% identical to GHRA_KLEP3: Glyoxylate/hydroxypyruvate reductase A (ghrA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 86% identity to eae:EAE_16195)

MetaCyc: 75% identical to glyoxylate/hydroxypyruvate reductase A (Escherichia coli K-12 substr. MG1655)
Glyoxylate reductase (NADP(+)). [EC: 1.1.1.79]; 1.1.1.- [EC: 1.1.1.79]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.79

Use Curated BLAST to search for 1.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2C6 at UniProt or InterPro

Protein Sequence (312 amino acids)

>BWI76_RS10890 glyoxylate/hydroxypyruvate reductase A (Klebsiella michiganensis M5al)
MDIIFYHPTFDTPFWIAELEKQLPGSRVREWKSGDNQPADYALVWHPPVEMLQGRELKAV
FALGAGVDSILSKLRENPEMLPLSTPLFRLEDTGMGLQMQEYAVSQVLHWFRRFDDYQAL
KQEARWQPLEEYQREDFTIGIMGAGVLGAKVAESLQSWGFPLRVWSRSRKSWPQVTSFAG
KAELGDFLNGTRVLINLLPNTAETVGIINSARLAQLPDNSYVLNLARGVHVVEDDLLVAL
DSGNLKGAMLDVFSREPLPEESPLWRHPRVAMTPHIAAVTRPLEAIAYIAKTIAQLERGE
TVSGQVNRQLGY