Protein Info for BWI76_RS10855 in Klebsiella michiganensis M5al

Annotation: RND family efflux transporter MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 71 to 376 (306 residues), 227.3 bits, see alignment E=1.2e-71 PF16576: HlyD_D23" amino acids 83 to 287 (205 residues), 48.1 bits, see alignment E=1.3e-16 PF13437: HlyD_3" amino acids 194 to 288 (95 residues), 34.1 bits, see alignment E=5.7e-12

Best Hits

KEGG orthology group: None (inferred from 71% identity to enc:ECL_02243)

Predicted SEED Role

"FIG00732359: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B260 at UniProt or InterPro

Protein Sequence (382 amino acids)

>BWI76_RS10855 RND family efflux transporter MFP subunit (Klebsiella michiganensis M5al)
MLYELVLSLRQCVYALLGAERSLPWFALLPPIVLALMIVPLVGCGDKSGDKPAPARPVRY
VVIGSPATLPSLERTGEIHAHDETALSFRTAGRMMTRAVDIGDRVNYGQLLATLDDTSAQ
NQLDSATADEESARATARVAALNVSRMQKLIATGAIARSQLDSARADWLVASARVKSSEA
ALRNARESLGWTRLTSPGEGIITAVSASPGQVVNAGETVVTLAAGQARDVVFDIPDPAKV
EAQRAEEFQVALLSDAGVNAFAILRDISPQADPQTRTWRVRATLKKPPAAMALGSSVTVR
LPSSGSAGYAVPASALSRCGEKPAVFVITPQMQAQLRVVVPASYTASSVIIASGLMPGDR
VITAGVSKLRPGEKVVAGEKQP