Protein Info for BWI76_RS10850 in Klebsiella michiganensis M5al

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details PF00512: HisKA" amino acids 177 to 233 (57 residues), 37.2 bits, see alignment E=2.4e-13 PF02518: HATPase_c" amino acids 278 to 389 (112 residues), 79.3 bits, see alignment E=2.9e-26

Best Hits

KEGG orthology group: None (inferred from 78% identity to enc:ECL_02242)

Predicted SEED Role

"two-component system sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B242 at UniProt or InterPro

Protein Sequence (398 amino acids)

>BWI76_RS10850 two-component sensor histidine kinase (Klebsiella michiganensis M5al)
MIKTRHSSLWRWICGRILALAIGSVIVIATCMWLRFAVQNYWIMHKMPPALREEFIALSR
HPEANPARFHQIVDSWWGLSYSTPSIASADWVTFAVLVLVMIPFIVVMGLRYARPLSLQF
SRLRDAAKDVTGGQFGRQAELIEDAPAEMIRFAADFNKMTGQLARYDKELRASHVAMAHE
LRSPLTAAIGRLQGMLDGVFDTQPQQLEMVMKQLQHLNRLTDELHLLSLADAGNLVLDDQ
PFALDELLQERAAWLTPQADAQRVTIAIQPSPACPFRGDAFRMGQVFTIVMENAVRYGRK
GGHLSIKLRREEGAYLIDFVDDGPGVARHFLPEMFQRFTREEASRARHSGGSGLGLSIAR
AICAAHGGRISASPPASGGLLIRVHLPYDPGAEEKSAS