Protein Info for BWI76_RS10825 in Klebsiella michiganensis M5al

Annotation: deferrochelatase/peroxidase EfeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR01412: Tat-translocated enzyme" amino acids 5 to 425 (421 residues), 590.3 bits, see alignment E=3e-181 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 12 to 38 (27 residues), 18 bits, see alignment (E = 4.3e-07) TIGR01413: Dyp-type peroxidase family" amino acids 64 to 412 (349 residues), 341.7 bits, see alignment E=6.9e-106 PF04261: Dyp_perox_N" amino acids 64 to 216 (153 residues), 154.7 bits, see alignment E=1.8e-49 PF20628: Dyp_perox_C" amino acids 230 to 412 (183 residues), 177.9 bits, see alignment E=1.5e-56

Best Hits

Swiss-Prot: 85% identical to EFEB_ECO57: Deferrochelatase/peroxidase EfeB (efeB) from Escherichia coli O157:H7

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 90% identity to kpe:KPK_3510)

MetaCyc: 85% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B271 at UniProt or InterPro

Protein Sequence (426 amino acids)

>BWI76_RS10825 deferrochelatase/peroxidase EfeB (Klebsiella michiganensis M5al)
MAEQKYDVNEPSRRRLLKGIGALGGALAITGGCPVAHAAKDNSSPGTLSPNARMEAQPFY
GPHQAGVLTPQQASMMLVAFDVLASDKADLERLFRLLTGRIAFLTKGGPAPETPNPRLPP
MDSGILGPWIAPDNLTITVSVGHSLFDERFGLANQAPKTLQKMTRFPNDSLDAALCHGDL
LLQICANTQDTVIHALRDVIKHTPDLLSVRWKREGFISDSAARSKGKETPVNLLGFKDGT
ANPVSTDKALMDKVVWVTADQGEPAWATGGSYQAARIIQFHVEFWDRTPLKEQQTIFGRD
KLSGAPLGMQHEHDVPDYSKDPDGDTIALDSHIRLANPRTPETQSSLMMRRGYSYSLGVT
NSGQLDMGLLFVCYQHDLEKGFLTVQKRLNGEALEEYVKPIGGGYFFVLPGVIDDRHYLG
QSLLEA