Protein Info for BWI76_RS10815 in Klebsiella michiganensis M5al

Annotation: iron permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 117 to 142 (26 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 248 to 264 (17 residues), see Phobius details PF03239: FTR1" amino acids 1 to 262 (262 residues), 282.8 bits, see alignment E=1.5e-88 TIGR00145: FTR1 family protein" amino acids 1 to 263 (263 residues), 327.7 bits, see alignment E=3.5e-102

Best Hits

Swiss-Prot: 88% identical to EFEU_SHISS: Ferrous iron permease EfeU (efeU) from Shigella sonnei (strain Ss046)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_16075)

Predicted SEED Role

"Ferrous iron transport permease EfeU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B239 at UniProt or InterPro

Protein Sequence (276 amino acids)

>BWI76_RS10815 iron permease (Klebsiella michiganensis M5al)
MFVPFLIMLREGLEAALIVSLIASYLKRTQRGSWIGVMWIGVLLAAALCLGLGIFINETT
GEFPQREQELFEGIVAVVAVCILTWMVFWMRKVSRNVKQQLEQAVDNALQRGNNHGWALV
MMVFFAVAREGLESVFFLLAAFQQDVGIWPPIGAMLGLATAIVLGFLIYWGGIRMNLGVF
FKWTSLFILLVAAGLAAGAIRAFHEAGLWNHFQEVAFDLSNVISTHTLFGTLLEGIFGYQ
ETPTVSEVAVYFIYLIPALALYVSPPGKKTTASRAA