Protein Info for BWI76_RS10775 in Klebsiella michiganensis M5al

Annotation: pyrimidine utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03614: pyrimidine utilization protein B
  • amino acids 3 to 226 (224 residues), 440.3 bits, E=7.3e-137
• PF00857: Isochorismatase
  • amino acids 18 to 215 (198 residues), 140.8 bits, E=2.6e-45

Best Hits

Swiss-Prot: 93% identical to RUTB_KLEP7: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 92% identity to kpe:KPK_3521)

MetaCyc: 87% identical to ureidoacrylate amidohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-12896 [EC: 3.5.1.110]; 3.5.1.110 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• allantoin degradation IV (anaerobic) (8/9 steps found)
• uracil degradation III (5/5 steps found)
• L-citrulline degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• superpathway of allantoin degradation in yeast (5/6 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• cyanate degradation (2/3 steps found)
• cyanuric acid degradation II (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.- or 3.5.1.110

Sequence Analysis Tools

See A0A285B1Y6 at UniProt or InterPro

Protein Sequence (236 amino acids)

>BWI76_RS10775 pyrimidine utilization protein B (Klebsiella michiganensis M5al)
MITLPARPESLTFAPQQSALIVVDMQNAYASQGGYLDLAGFDVSATRPVIDNINLAVAAA
RAAGMLIIWFQNGWDDQYVEAGGPGSPNFHKSNALKTMRKNPELQGKLLAKGGWDYQLVD
QLKPLPGDIVLPKPRYSGFFNTALDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYF
GIVLEDATHQAGPAFAQQAALFNIETFFGWVSDVASFCTALEPAAPRAFTEEKRYA