Protein Info for BWI76_RS10770 in Klebsiella michiganensis M5al

Annotation: pyrimidine utilization protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 TIGR03610: pyrimidine utilization protein C" amino acids 1 to 127 (127 residues), 253.2 bits, see alignment E=2.2e-80 PF01042: Ribonuc_L-PSP" amino acids 14 to 125 (112 residues), 117.3 bits, see alignment E=2e-38

Best Hits

Swiss-Prot: 96% identical to RUTC_KLEVT: Putative aminoacrylate peracid reductase RutC (rutC) from Klebsiella variicola (strain At-22)

KEGG orthology group: K09021, UPF0076 protein RutC (inferred from 93% identity to ctu:CTU_15910)

MetaCyc: 84% identical to 3-aminoacrylate deaminase (Escherichia coli K-12 substr. MG1655)
RXN0-6452

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B230 at UniProt or InterPro

Protein Sequence (130 amino acids)

>BWI76_RS10770 pyrimidine utilization protein C (Klebsiella michiganensis M5al)
MPKQVIIPPGTTTPIAPFVPGTLADGVVYVSGTLPFDKQNNVVYIGDPKAQTRHVLETIK
SVIETAGGSMEDVTFNSIFITDWKNYAAINEVYAEFFPGDKPARFCIQCGLVKPDALVEI
ATVAHIGKPA