Protein Info for BWI76_RS10760 in Klebsiella michiganensis M5al
Annotation: nitroreductase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to RUTE_KLEP3: Probable malonic semialdehyde reductase RutE (rutE) from Klebsiella pneumoniae (strain 342)
KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 85% identity to kpu:KP1_2022)MetaCyc: 77% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]
Predicted SEED Role
"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
MetaCyc Pathways
- uracil degradation III (5/5 steps found)
- β-alanine degradation III (1/2 steps found)
- 3-hydroxypropanoate cycle (7/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
- glyoxylate assimilation (5/13 steps found)
- superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.298
Use Curated BLAST to search for 1.-.-.- or 1.1.1.298
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B241 at UniProt or InterPro
Protein Sequence (196 amino acids)
>BWI76_RS10760 nitroreductase family protein (Klebsiella michiganensis M5al) MSEAISPAACAALFTEARTHNGWLDKPVSDEQLREIYDLLKMGPTSANCSPARIVFVRTA EGKTKLRPALSSGNVEKTMQAPATAIVAWDRAFYDRLPELFPHGDARSWFTSSPQMAEET AFRNSSLQAAYLIFACRALGLDTGPMSGFDREMVDAAFFADGGWKSNLLINIGYGDPGKL YGRLPRLPFDDACQLA