Protein Info for BWI76_RS10740 in Klebsiella michiganensis M5al

Annotation: NAD(P)H:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01755: NAD(P)H:quinone oxidoreductase, type IV
  • amino acids 2 to 196 (195 residues), 337.9 bits, E=1.1e-105
• PF03358: FMN_red
  • amino acids 3 to 143 (141 residues), 53.3 bits, E=2.4e-18
• PF00258: Flavodoxin_1
  • amino acids 6 to 123 (118 residues), 41.5 bits, E=1.6e-14

Best Hits

Swiss-Prot: 96% identical to NQOR_KLEP3: NAD(P)H dehydrogenase (quinone) (KPK_3530) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 96% identity to enc:ECL_02631)

MetaCyc: 91% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Flavoprotein WrbA"

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

See A0A285B1X5 at UniProt or InterPro

Protein Sequence (198 amino acids)

>BWI76_RS10740 NAD(P)H:quinone oxidoreductase (Klebsiella michiganensis M5al)
MAKILVLYYSMYGHIETMAHAVAEGANKVDGVEVVVKRVPETMQAEVFAKAGGKTQNAPV
ATPQELAEYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQ
EQTITSTWTTLAHHGMIIVPIGYGAQELFDVSQVRGGTPYGATTIAGGDGSRQPSEEELA
IARYQGEHVAGLAVKLHG