Protein Info for BWI76_RS10670 in Klebsiella michiganensis M5al

Annotation: PTS fructose transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details TIGR01427: PTS system, Fru family, IIC component" amino acids 10 to 334 (325 residues), 284.2 bits, see alignment E=8.6e-89

Best Hits

Swiss-Prot: 86% identical to PTFC2_ECOLI: Fructose-like permease IIC component 2 (frwC) from Escherichia coli (strain K12)

KEGG orthology group: K11203, PTS system, fructose-specific IIC-like component (inferred from 94% identity to kpu:KP1_1992)

MetaCyc: 86% identical to putative PTS enzyme IIC component FrwC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIC component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>BWI76_RS10670 PTS fructose transporter subunit IIC (Klebsiella michiganensis M5al)
MNELVQILKNTRQHLMTGVSHMIPFVVSGGILLAVSVMLYGKGAVPDAATDPNLKKLFDI
GVAGLTLMVPFLAAYIGYSISDRAALAPCAIGAWVGNSFGAGFFGALIAGIIGGLVVYYL
KKIPVHKVLRSVMPIFVIPIIGTFITAGIMMWGLGEPIGALTASLTGWLQGMREGSIVIL
AIIMGLMLAFDMGGPVNKVAYAFMLICVSQGVYSVVAIAAVGIAVPPLGMGLATLIGRKY
FSAEERETGKAALVMGCVGVTEGAIPFAAADPLRVIPANMIGAAAGCVTAALLGAQCYAG
WGGLIVLPVVEGKGGFIAGLAVGAIVSAACVILLKALAKKKTSDAKADDEMDLDFEIN