Protein Info for BWI76_RS10655 in Klebsiella michiganensis M5al

Annotation: [formate-C-acetyltransferase]-activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 68% identical to PFLC_ECOLI: Pyruvate formate-lyase 2-activating enzyme (pflC) from Escherichia coli (strain K12)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 81% identity to kpu:KP1_1988)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

superpathway of N-acetylneuraminate degradation (22/22 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
mixed acid fermentation (16/16 steps found)
superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
pyruvate fermentation to acetate IV (3/3 steps found)
pyruvate fermentation to ethanol I (3/3 steps found)
(S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
reductive monocarboxylic acid cycle (2/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B202 at UniProt or InterPro

Protein Sequence (291 amino acids)

>BWI76_RS10655 [formate-C-acetyltransferase]-activating enzyme (Klebsiella michiganensis M5al)
MTLSAAPRISCEVMETRADKARIFNIQRYSLNDGQGIRTVVFFKGCPHTCPWCANPESIS
PKIQTVRRESKCLRCSRCQQDVVECPSGAWEQIGRDVTLDNLLKEVLKDEVFFRASGGGV
TLSGGEVLMQAEFAARFLRRLREWGVRTAIETAGDSAFSRFFPLAQACDEVLFDLKIMDE
ALAREQLRMNMPRVLDNFARLVDAHIHVIPRVPLIPGFTLNEENFRQILAFLAPFKLPEI
HLLPFHQYGEPKYHLLGKTWSMLMIKAPAESEIQPFKTLAERAGFSVTVGG