Protein Info for BWI76_RS10635 in Klebsiella michiganensis M5al

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 146 to 297 (152 residues), 117.7 bits, see alignment E=2.1e-38 PF00990: GGDEF" amino acids 150 to 294 (145 residues), 125.5 bits, see alignment E=8.6e-41

Best Hits

KEGG orthology group: None (inferred from 77% identity to kva:Kvar_3377)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B291 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BWI76_RS10635 GGDEF domain-containing protein (Klebsiella michiganensis M5al)
MAEREKNIHIQPSSSISRTHIFPALLAIAAVSGLCAFVSPPLGPWRVILSNPGMYIDLLA
LLFLLFMLWSSTKVRMNHVAVNWVRYGLLLWIAGGTFDLMDEIFRQPRWMGYYCEDLLRL
TGMLLSAVGVYKIIERINLLYVDARSQSLKDELTQLPNRRFFIDTVREKAGNTQALMIVD
IDYFKKINDTYGHLVGDEVLFALGKQLAKLTSDKVLPSRIGGEEFAIIVDGLSAQEVDEL
AQSILQNARAILINHDNPLSISIGVGLRHKDEPQNQFIKKVDDALYKAKNNGRGRVEWAV