Protein Info for BWI76_RS10470 in Klebsiella michiganensis M5al

Annotation: iron ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13531: SBP_bac_11" amino acids 41 to 288 (248 residues), 68.1 bits, see alignment E=2e-22 PF01547: SBP_bac_1" amino acids 41 to 284 (244 residues), 72.2 bits, see alignment E=1.6e-23 PF13416: SBP_bac_8" amino acids 47 to 287 (241 residues), 75.8 bits, see alignment E=1e-24 PF13343: SBP_bac_6" amino acids 81 to 315 (235 residues), 80.2 bits, see alignment E=3.4e-26

Best Hits

Swiss-Prot: 82% identical to FBPA_SERMA: Fe(3+)-binding periplasmic protein (fbpA) from Serratia marcescens

KEGG orthology group: None (inferred from 90% identity to eae:EAE_15860)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1S4 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BWI76_RS10470 iron ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MRFRLVSYCSAALMASSAFIAPQALAAASSDGIVVYNAQHENLVKSWVDGFTKETGIKVT
LRNGGDSELGNQLVQEGTASPADVFLTENSPAMVLVDNAKLFAPLAAETLQQVAPQYRPE
HGRWIGIAARSTVFVYNPAKISEAQLPKSLMDLAQPQWKGRWAASPSGADFQAIVSAMLA
LKGEQATLAWLKAMKTNFVAYKGNSTVMKAVNAGQIDGGVIYHYYRFVDQAKTGENSKNT
RLHYFKNQDPGAFVSISGGGVLASSKHQEQAQAFIKWITGKQGQDELRTNNAFEYAVGVN
AASNPKLTPLQALEAPKVEPSSLNSKKVVDLMTQAGLL