Protein Info for BWI76_RS10460 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator LeuO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00126: HTH_1" amino acids 25 to 83 (59 residues), 64.8 bits, see alignment E=5.5e-22 PF03466: LysR_substrate" amino acids 117 to 310 (194 residues), 78.5 bits, see alignment E=4.9e-26

Best Hits

Swiss-Prot: 63% identical to LEUO_SALTY: Probable HTH-type transcriptional regulator LeuO (leuO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 67% identity to eae:EAE_11190)

Predicted SEED Role

"Probable transcriptional activator for leuABCD operon" in subsystem Leucine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1V9 at UniProt or InterPro

Protein Sequence (315 amino acids)

>BWI76_RS10460 transcriptional regulator LeuO (Klebsiella michiganensis M5al)
MSENTTSKPTSEPKVLQPVLRKVDLNLLTIFDTVMQEQSLTKAAQTLGMSQPAVSSAVSR
LKVLFKDELFVRNGRGIKPTERAFQLFSSVRRALSLVQNELPDTLFDPLDCERLYTLCVC
SPLDNYLTPLIFNKISEIAPRVSLSFKSSLSQQVTNQLRYQEVEFVLDYNKFNHPEFTSI
PLFNDKMVLVARCNHPRIASPLSEEDIYREQHATVALDRYASFSSPWYSSEEQQACVAFH
GNAMVSVLSVVSQTNMVAIAPEWLAQEFEEQFGLQLLPLPLEMDSRTCYLSWHETAGQER
SHRWMAELLIKICQR