Protein Info for BWI76_RS10440 in Klebsiella michiganensis M5al

Annotation: protein-disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 276 to 297 (22 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 356 to 380 (25 residues), see Phobius details amino acids 401 to 427 (27 residues), see Phobius details amino acids 433 to 454 (22 residues), see Phobius details amino acids 474 to 493 (20 residues), see Phobius details amino acids 500 to 517 (18 residues), see Phobius details amino acids 524 to 544 (21 residues), see Phobius details PF11412: DsbD_N" amino acids 35 to 143 (109 residues), 62.1 bits, see alignment E=1.1e-20 PF28432: DUF8393" amino acids 165 to 263 (99 residues), 68.5 bits, see alignment E=8.3e-23 PF02683: DsbD_TM" amino acids 277 to 487 (211 residues), 75.3 bits, see alignment E=9e-25 PF13899: Thioredoxin_7" amino acids 562 to 648 (87 residues), 52.7 bits, see alignment E=7.9e-18

Best Hits

KEGG orthology group: None (inferred from 69% identity to enc:ECL_01939)

Predicted SEED Role

"Membrane protein, suppressor for copper-sensitivity ScsB" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1R7 at UniProt or InterPro

Protein Sequence (674 amino acids)

>BWI76_RS10440 protein-disulfide reductase (Klebsiella michiganensis M5al)
MLNIFRGFVFLLLTCAGVAHGADTGWLTSPQHDHARIRFQAEKGKDRIDGLLSIELASGW
KTYWRSPGEGGVAPQIIWNNGERARWYWPTPSRFKISGLTTQGYHDRVAIPMTIAAAPGD
VLEGMLTLSTCSNVCLLTDYRLHLDFNQPADGEFRNAFARAMRAVPADNGVTNDLAAHLV
GSQLVITATTTGEWKNPGVYFDPMDGGIVAGDPEIRAEGDRLKVTVPVTDEWGEIPATLA
GKALSLVLTNGEKAQQINLTTGADLAPTATVSLGKIVLFALLGGVILNLMPCVLPVMGMK
LSAVLQAGADRGRVRLRFLATSAGILTSFALLALMVMILKLTGASLGWGIQFQNPWFIGV
MVAVTFLFALNLFGIVEMLLPSAAVSRMATAGGAGIAGSFCEGVFATLLATPCSAPFLGT
AVAFALAAPFHELWLIFMVLGLGMAAPWLFVALFPQTAALLPRPGRWMNSLKMALGVMML
ASSFWLTTLLGVHLGETSSVVMTLTLTVAALIALLVAHQRTTPAFWLVVIALAAYGGFQV
RGLLAQGSTVSSPQANAQQIRWQPLSEEAIRSARAEGKRVFIDISADWCVTCKVNELRVL
NQPAIIRALAQPDVVALRGDWSKPSEPIARFLQSRNRYAIPFNQVYGPGQPQGEMLPPLL
DQQTVLKALNRAKG