Protein Info for BWI76_RS10345 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 329 (322 residues), 116.9 bits, see alignment E=5e-38

Best Hits

KEGG orthology group: None (inferred from 90% identity to kpe:KPK_A0111)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1N8 at UniProt or InterPro

Protein Sequence (379 amino acids)

>BWI76_RS10345 MFS transporter (Klebsiella michiganensis M5al)
MLRIYLYLILAASVSALATDMIVPALPLLQKAFHSDYSSIQLTISGFLVIYACSQLLSGF
IGEKLGKLRVLTASFLLFLAGSLLCFISDSLSMLLAGRALQAVGAGAGPVLSKAIAKETF
SPLTLKRALSDISSASAVVPLIAPLAGAAILGHLSWNHIFLVMALFSVVTLLLSPRRLGH
RDSAAAPSSSGFITPAFIQGTLLVSLILSSLFCYISLSPAIFMQQLGLSTMHYSLLFSAS
VLFFIIGNQFSKFERINNPWILFIMNALAVSPFIIGCHSLILCIAGSMIFNFSLGAYYPT
ANFIALQIKGTKTGIAASVTGFIQTVCAGAISYFAVKLTDTGLGFDRTLGTSTLTLAILS
LLVVTTMKVTQWKTGKKGK