Protein Info for BWI76_RS10320 in Klebsiella michiganensis M5al

Annotation: alpha-glucosidase/alpha-galactosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02056: Glyco_hydro_4" amino acids 3 to 188 (186 residues), 210.1 bits, see alignment E=2e-66 PF11975: Glyco_hydro_4C" amino acids 198 to 407 (210 residues), 218.2 bits, see alignment E=1.3e-68

Best Hits

Swiss-Prot: 67% identical to AGAL_BACSU: Alpha-galactosidase (melA) from Bacillus subtilis (strain 168)

KEGG orthology group: K07406, alpha-galactosidase [EC: 3.2.1.22] (inferred from 94% identity to srs:SerAS12_3178)

Predicted SEED Role

"Alpha-galactosidase (EC 3.2.1.22)" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Galactosylceramide and Sulfatide metabolism or Lactose and Galactose Uptake and Utilization or Melibiose Utilization (EC 3.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.22

Use Curated BLAST to search for 3.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1P1 at UniProt or InterPro

Protein Sequence (435 amino acids)

>BWI76_RS10320 alpha-glucosidase/alpha-galactosidase (Klebsiella michiganensis M5al)
MIKVTFMGAGSTIFARNVLGDIMATPTLKEVEIALYDIDGARLNESLAMLNNINSNTNAG
RAKIAAYLGVENRRAALKNAHYVVNAIQVGGYDPCTITDFTIARKYGLRQTIADTLGIGG
IFRALRTIPVMFDFARDIEAVCPNAWLLNYTNPMATITGAMLRHTEVKTVGLCHSVQVCA
ETLLKSVDMPTDDVQFHIAGINHMAWLLDIRRHGEDLYPEIKRRASALQGKHDDMVRHEI
MKTFGYYVTESSEHNAEYMPYWIKRNYPELIERFNIPLDEYPRRCIEQIEQWQQQKVALT
HDTSLTHSRTHEYASYIIEAMETDRPYKIGGNVLNTGLIANLPSEACVEVPCLVDGQGVT
PCYVGNLPEQLAALNRTNINTQLLTVEAAVTRKREAIYHAALLDPHTSAELSIDDIRKLC
DELIEAHSNWLPAYH