Protein Info for BWI76_RS10315 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details PF01306: LacY_symp" amino acids 2 to 404 (403 residues), 559.7 bits, see alignment E=5.5e-172 TIGR00882: oligosaccharide:H+ symporter" amino acids 6 to 401 (396 residues), 559.4 bits, see alignment E=2.1e-172 PF12832: MFS_1_like" amino acids 10 to 381 (372 residues), 75.8 bits, see alignment E=5.7e-25 PF07690: MFS_1" amino acids 17 to 338 (322 residues), 84.8 bits, see alignment E=8.5e-28

Best Hits

Swiss-Prot: 63% identical to LACY_ECOLI: Lactose permease (lacY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to srr:SerAS9_3176)

MetaCyc: 63% identical to lactose permease (Escherichia coli K-12 substr. MG1655)
RXN-17755; RXN0-7215; RXN0-7217; TRANS-RXN-24; TRANS-RXN-94

Predicted SEED Role

"Lactose permease" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Lactose and Galactose Uptake and Utilization or Lactose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1V2 at UniProt or InterPro

Protein Sequence (430 amino acids)

>BWI76_RS10315 MFS transporter (Klebsiella michiganensis M5al)
MFYLKNRNFWIFGAFCFFYFFIMGAVLPFFPIWLHDVNQLDQRQTGLVFASMALFALVFQ
PVFGFVTDKFGLKKHLLWMIIFLLLFLAPLFIYVFSPLLQSHFFLGALLCGIYLGLVCSG
GSPAIEAYIEKVSRRSQFEYGRARLFGCIGWAICASIVGYMFTINNQFAFWLASSFSLVL
AGLLYLFKPEENATLAVADGLALNQKPIKLKAALGLLKMRKFWCLVMYIVGVACVYDVFD
QQFANFFTSFFRDRHTGTQAFGYVTTPGEFLNAFIMFFAPPIINRIGGKNALLIAGMIMS
ARIIGSSLADSVTEVIILKTLHMFEVPFLLVGIFKYITTQFNVNLSASIYLWGFCFFKQL
SAIGMSYAAGMMYVTYGFKTSYLILGCTALLFTIISAFALSGKVRRATGQPAQDVSLSNI
KGEFGSEAQR