Protein Info for BWI76_RS10300 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 24 to 51 (28 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 373 to 400 (28 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 31 to 435 (405 residues), 250.7 bits, see alignment E=1.4e-78 PF07690: MFS_1" amino acids 33 to 425 (393 residues), 168.5 bits, see alignment E=1e-53

Best Hits

KEGG orthology group: None (inferred from 78% identity to kpe:KPK_3283)

Predicted SEED Role

"Drug resistance transporter EmrB/QacA subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1V3 at UniProt or InterPro

Protein Sequence (478 amino acids)

>BWI76_RS10300 MFS transporter (Klebsiella michiganensis M5al)
MNIHQGKLVKETTHPRPTNAIPPVLWMQAAIITLGAFSTMLSSTMLSAALPAMAIGLGVP
DSAIQWIATAYLMALAAGVPLSAWAVRRFGATQLWLYGLILFAIFSAVCALSPRFEVLLA
ARMLQGLAGGLLVPAGQTILGLVVGRERLGRVIGTIGVAIVIAPLLGTSLGALLVESCGW
RGLFWITVPFCLCAYLTGWKLLPRPAIKNDRPLSLDWLGLALVFCSLPMLMEGMKELSLN
NGKYGWNVIMLSVGALFTCLFIYRSLRIESPLLHLGLFKHRGFTLSAVLMTIGGAVNFGG
QFLLPLYFRDVCHKTLAEVGLLLTPQLIGSAIGFPVAGYFSDKLGPRAVLIVGGLLAAFA
TLPLGMIDAQSRYSLVGGAIAVRGFGLALATVPAMAAGMAMAGSRHVADAAPILNILQRI
GAMAGTALITASYIRFAPTNGSLTAFHHAGWILTAGAVLLALCAFFMVNHSVLTTQEE