Protein Info for BWI76_RS10280 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 109 (97 residues), 99.2 bits, see alignment E=8.2e-33 PF00528: BPD_transp_1" amino acids 33 to 211 (179 residues), 76.2 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 36% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 95% identity to kpe:KPK_3287)

MetaCyc: 36% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"FIG00731437: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1P6 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS10280 polar amino acid ABC transporter permease (Klebsiella michiganensis M5al)
MSIELMWQYFLSPEFVQGAWMTLLITLCSLLCGVVLGLVLALLQEAPFRAGKGLAFFYLW
LFRGTPVLFQIIFVYNVLPGFGLRFSAFTCAVLALSLNEGAYMAEILRSGLQAVKSGQRT
AGMALGMTSGQIMRKIVLPQAARIVLPPMGNQMISMLKSSALVSVIAVQELLLVANQTAS
ASFRYFEALCAAGIYYLLLTSLFMVFQSWLESVLDPKQRRSKSQKRLNRLFKLPKPAREE
P