Protein Info for BWI76_RS10260 in Klebsiella michiganensis M5al

Annotation: creatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF01321: Creatinase_N" amino acids 23 to 157 (135 residues), 72.7 bits, see alignment E=4.2e-24 PF00557: Peptidase_M24" amino acids 164 to 373 (210 residues), 134.7 bits, see alignment E=4e-43

Best Hits

KEGG orthology group: K01271, Xaa-Pro dipeptidase [EC: 3.4.13.9] (inferred from 97% identity to kva:Kvar_3159)

Predicted SEED Role

"peptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.13.9

Use Curated BLAST to search for 3.4.13.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1R9 at UniProt or InterPro

Protein Sequence (389 amino acids)

>BWI76_RS10260 creatinase (Klebsiella michiganensis M5al)
MQDVNNVIQGSESAFSADEYAQRIRRTRERLSSAGVDVMIVTGPENIFWLTGQQTPGYYT
FQALLLPVEGDPVFVIRQLEYFNFIANTFISDAAIYQDGDNPVDFLVAMLQQRGWLNKRI
GLDKRGWFLPIAVYEALQSKLGAIADTAGVIEPLRAVKSAAEVEKIAAAARYVDAGMRAG
MAAIRSGADENALVSAMMGAAIAAGSEYVGMEPLVSTGPRSGVPHGTWRRRVMQDNDPVF
LEMSAAHDRYHAAMMRSAWLGRPPAIAIEMEKVCQEALQASLDAIRPGATCEAPHLACQK
VIDRAGFTENFKKRTGYSIGIAFAPDWGEGGILSLYSGVTTELQPGMTFHIPPALRIYGQ
FTVGVSETVVVTETGYRQLGSLARPLTLL