Protein Info for BWI76_RS10225 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 352 to 377 (26 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 5 to 456 (452 residues), 330.6 bits, see alignment E=7.7e-103 PF00083: Sugar_tr" amino acids 15 to 458 (444 residues), 317.5 bits, see alignment E=2.4e-98 PF07690: MFS_1" amino acids 20 to 402 (383 residues), 118.7 bits, see alignment E=4.2e-38 PF06609: TRI12" amino acids 59 to 200 (142 residues), 28.3 bits, see alignment E=9.9e-11

Best Hits

KEGG orthology group: None (inferred from 94% identity to kva:Kvar_3232)

Predicted SEED Role

"Major myo-inositol transporter IolT" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>BWI76_RS10225 MFS transporter (Klebsiella michiganensis M5al)
MSTRKRNVPYLIFICAIASVSGIILGYDASVISGVIDPLTEHLSLTPAQSGWAVSNVILG
CIVGAWGVGRFTDRFGRKATLIITAILFAISAIGSALANDLTWFVVYRMIGGLAVGMASA
VTPLYIAEVSPKDLRGRMLGMQQMLMVGGQLVVYIVNYLIARGMAHEWVVSIGWRWMLAS
ALIPCVLFLVMVFFMPESPRWYAMRNQKEKSLKVLTSLSNPGHAERLYAEIRTSIATDSA
LLSIPTPRGILRDKKSSYILWIGCAIAVLQQVSGINILMYFAPSLLQNVTGNTQDSMFQS
IFLGLALLAGVSIALVAFDRIGRLPLLRWGSLGCAAFLLFTSWAFMNEVKGYLPIVGLVG
FIFVFGMSWSLGAWLLISEIFPNRMRAVAMGYAFCSMWVSNFIVTQSFPMMNRNPVLMEH
FHGAFPLLLCSGFSIIAFWFVGRFLPETKGVSLENIEPLMLSKSRRFGREQQMLVTPESV
SQK