Protein Info for BWI76_RS10025 in Klebsiella michiganensis M5al

Annotation: secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details PF25917: BSH_RND" amino acids 76 to 271 (196 residues), 30.2 bits, see alignment E=5e-11 PF26002: Beta-barrel_AprE" amino acids 287 to 379 (93 residues), 78.8 bits, see alignment E=4e-26

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 89% identity to kpn:KPN_00997)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1R6 at UniProt or InterPro

Protein Sequence (401 amino acids)

>BWI76_RS10025 secretion protein HlyD (Klebsiella michiganensis M5al)
MSKFPLLADNDPVALLPESEQDEAQIVKSRRLILLLAVMLLVGGVWAWFAVLDEVSTGTG
KVIPSSREQVIQTLDGGILTELNVREGSKVQAGQVVARLDPTRSESNVGESQAKYRASLA
ASIRLTAEVNNQPLAFPDSLKAWPALLAEETRLYHSRKEQLSKSTRQLDESLKLVNSELA
ITERLAKTGAASNVEVLRLRQQVADISFKKIDLNTRYFVDAREQLSKANADVASLAEVIK
GRADSVTRLTVRSPVQGIVKNIKVNTIGGVIAPNGELMEIVPVDGRLLIEARISPRDIAF
IHPDQQALVKITAYDYAIYGALNGVVETISPDTTQDEAKPDIYYYRVFIRTDYDYLENKS
GKRFLIGPGMIATVDIKTGEKTVMDYLVKPFNRAKEALRER