Protein Info for BWI76_RS10020 in Klebsiella michiganensis M5al

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 715 transmembrane" amino acids 164 to 188 (25 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 304 to 320 (17 residues), see Phobius details amino acids 386 to 410 (25 residues), see Phobius details amino acids 418 to 441 (24 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 16 to 708 (693 residues), 740.9 bits, see alignment E=6.8e-227 PF00664: ABC_membrane" amino acids 167 to 433 (267 residues), 100.1 bits, see alignment E=1.9e-32 PF00005: ABC_tran" amino acids 501 to 646 (146 residues), 84.5 bits, see alignment E=1.1e-27

Best Hits

KEGG orthology group: None (inferred from 86% identity to eae:EAE_15405)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1P0 at UniProt or InterPro

Protein Sequence (715 amino acids)

>BWI76_RS10020 ABC transporter (Klebsiella michiganensis M5al)
MTPQDERAGIPHLIDWSNAIAFIANHYRQSFSPGTLHAAAEWATQKTLPEALRHLARHAG
LNCQILSAADQKMSAWRLPLVIQLRDGQIAVVESVDVNNAVGVRFVKELALLSYCPLETL
LPEIEKTIAFRPAAPERDIRTESYLARFQPDWLRKIVLKDIRPYMHVMLASFAINVLALS
GILFSMQVYDRVIPAQSYPTLYVLFSGVLLAAVFAFVLKIMRGHVTDLLGKRGDIRVSDR
VFGHALRLKNSAVPRSTGSFISQIRELEQVREMMTSTMMTIVADLPFFLLFQVVLFIVSP
WLSWIAPVATVLMILPGLLLQRKLAALANKNQHENTLRNAILVESIQGLQDIKMMQAESR
FLHQWNSYIAITAESGVKTRRLTHGLVSWGMSVQNLLYATVVVVGAPLVINGDITTGAMV
AASMLSTRMVAPMTALCGVLARWQQVKTAKASLDTLMALPVEGGQDEPRVHRAVLHGNYE
FRQAEFRYGLNDAAIPLRINQLSIKAGERIAVLGRIGAGKSTLLQAMMGNIELVSGELRL
DDLSLPQIDLADIRRNATLLTQEARLFHGTLRENLILGRPAATDDEIFSVLTLCGALEFV
RKLPLGLEHVVMEGGLGLSGGQRQSLLLARTLLRDPNIILLDEPTSFFDERTEKAFVEQL
AQWAGERTMIIATHKAAVLNIVDRILVIQDGQLALDKPKATVFEQEKARGQVVNI