Protein Info for BWI76_RS10015 in Klebsiella michiganensis M5al

Annotation: putative outer membrane efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 69 to 471 (403 residues), 282.8 bits, see alignment E=2.5e-88 PF02321: OEP" amino acids 73 to 252 (180 residues), 98.3 bits, see alignment E=2.5e-32 amino acids 282 to 451 (170 residues), 50.7 bits, see alignment E=1e-17

Best Hits

KEGG orthology group: None (inferred from 80% identity to eae:EAE_15400)

Predicted SEED Role

"Type I secretion system, outer membrane component LapE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1S5 at UniProt or InterPro

Protein Sequence (478 amino acids)

>BWI76_RS10015 putative outer membrane efflux protein (Klebsiella michiganensis M5al)
MRLFKQKRNVITCGYTALFISLNPAFFAHAENSYLMPNDISSQRLTDSQQVAGYNEEIIN
SQSRISGPLDIKKAVKNAVNWHPSITQEVSKLQEMAQKVDVAKAKYYPQVSAGMNNGYSN
TYSDAGYTPSLVVSVSQMLYDFGKVSSSVRAADSGVAQQQATVMLSIDQVAHDTAAAVVQ
VQGYQKLVDIAKAQVESLKQIGDLIRQRNDAGASSLSDVVQTDTRVEGAQSTLLQYQAAL
ERWKATLATYIGIGGIATVTDDVPQGMDAACAVAKIDYRSVPAVLAALAQAGQAQAQLDN
ANAQMLPTISLEPEVTHYLNDNYANSAVLNKTQYSAWVKVQMPIYQGGAMTASRDAAQQS
LAAANAAIKTAQLDASQKLNASRDEAVNLTQSLGIQKRQQELGEQTRALYQDQYLQLGSR
PLLDLLNVDQEIYQARFSQVLTESQLRSLELDCLFSTGKMRTVFALEKQNIQGVEIRP