Protein Info for BWI76_RS09980 in Klebsiella michiganensis M5al

Annotation: competence protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 163 to 182 (20 residues), see Phobius details PF04993: TfoX_N" amino acids 15 to 106 (92 residues), 78.5 bits, see alignment E=3.4e-26 PF04994: TfoX_C" amino acids 117 to 194 (78 residues), 84.3 bits, see alignment E=5.2e-28

Best Hits

Swiss-Prot: 49% identical to SXY_ECOLI: Protein Sxy (sxy) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 70% identity to eae:EAE_15360)

Predicted SEED Role

"DNA transformation protein TfoX" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1Q6 at UniProt or InterPro

Protein Sequence (207 amino acids)

>BWI76_RS09980 competence protein (Klebsiella michiganensis M5al)
MKKLVCFRFHQFRACLTPLGKISCRPLFGGYSLAIDNTVFAMMAEGEIYLRVCEQSAEYR
VAHKNPLLKMQKNGRLVALKYYHIDEGLWQDSNMLFHLSALSLQSARYEKHRQRHSGRLK
NLPNISFHMELQLINSGITDELTLRKIGAKEAWLRLRKMNKALTVNILYCLQGAIAGVHA
ATLPTQQRQELEEWAAEQMQEREAYSG