Protein Info for BWI76_RS09970 in Klebsiella michiganensis M5al

Annotation: porin OmpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13505: OMP_b-brl" amino acids 8 to 201 (194 residues), 72.2 bits, see alignment E=9.6e-24 PF01389: OmpA_membrane" amino acids 23 to 204 (182 residues), 257 bits, see alignment E=1.4e-80 PF00691: OmpA" amino acids 232 to 327 (96 residues), 85 bits, see alignment E=5.9e-28

Best Hits

Swiss-Prot: 95% identical to OMPA_KLEPN: Outer membrane protein A (ompA) from Klebsiella pneumoniae

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 96% identity to kpn:KPN_00986)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1R5 at UniProt or InterPro

Protein Sequence (356 amino acids)

>BWI76_RS09970 porin OmpA (Klebsiella michiganensis M5al)
MKKTAIAIAVALAGFATVAQAAPKDNTWYAGAKLGWSQYHDTGFYGNGFKGNNGPVRNDQ
LGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIY
TRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGLEWAVTRDIATRLEYQWVNNIGD
AGTVGTRPDNGMLSLGVSYRFGQDDVAPVVAPAPAPAPEVTTKHFTLKSDVLFNFNKSTL
KPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSDAYNQQLSEKRAQSVVDYLVSKGI
PASKISARGMGESNPVTGNTCDNVKARAALIDCLGPDRRVEIEVKGYKDVVTQPQA