Protein Info for BWI76_RS09965 in Klebsiella michiganensis M5al

Annotation: macrodomain Ter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF06303: MatP" amino acids 2 to 85 (84 residues), 148.8 bits, see alignment E=5.1e-48 PF17414: MatP_C" amino acids 88 to 147 (60 residues), 103.2 bits, see alignment E=7.7e-34

Best Hits

Swiss-Prot: 96% identical to MATP_KLEP7: Macrodomain Ter protein (matP) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_15345)

Predicted SEED Role

"Macrodomain Ter protein YcbG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1Q2 at UniProt or InterPro

Protein Sequence (150 amino acids)

>BWI76_RS09965 macrodomain Ter protein (Klebsiella michiganensis M5al)
MKYQQLENLESGWKWTYLVKKHREGELITRYIEASAAQAAVDLLLTLENEPVLVNTWIEQ
HMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFVVWQRLAGLAQRRGKTLSETIV
QLIEDAEHKEKYASKMSSLKHDLQVLLGKE