Protein Info for BWI76_RS09945 in Klebsiella michiganensis M5al

Annotation: lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF03886: ABC_trans_aux" amino acids 26 to 180 (155 residues), 142.8 bits, see alignment E=3.8e-46

Best Hits

Swiss-Prot: 74% identical to PQIC_SHIFL: Intermembrane transport lipoprotein PqiC (pqiC) from Shigella flexneri

KEGG orthology group: None (inferred from 95% identity to eae:EAE_15325)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1I9 at UniProt or InterPro

Protein Sequence (187 amino acids)

>BWI76_RS09945 lipoprotein (Klebsiella michiganensis M5al)
MKKWLIAAAVCALTACSSGGDSKTYYQLPVAQGGAQSAAHQSKNLLWVEQVSIPDYLAGN
GVVYQTTDVQYVIANNNLWASPLDQQLRTTLVANLSNQLPGWVVASQPLGSEQDTLNVSV
SGFHGRYDGRVIVSGEWLLKHQGQLIKRPFHIELKQQEDGYDAMVKTLAQAWTQEATAIA
SELNRLP