Protein Info for BWI76_RS09920 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF03476: MOSC_N" amino acids 1 to 116 (116 residues), 105.5 bits, see alignment E=2.5e-34 PF03473: MOSC" amino acids 140 to 262 (123 residues), 57.9 bits, see alignment E=1.7e-19 PF00111: Fer2" amino acids 296 to 362 (67 residues), 52.7 bits, see alignment E=5.1e-18

Best Hits

Swiss-Prot: 78% identical to YCBX_ECOLI: Uncharacterized protein YcbX (ycbX) from Escherichia coli (strain K12)

KEGG orthology group: K07140, (no description) (inferred from 90% identity to kpu:KP1_1948)

MetaCyc: 78% identical to 6-N-hydroxylaminopurine resistance protein (Escherichia coli K-12 substr. MG1655)
RXN0-7398

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1Q5 at UniProt or InterPro

Protein Sequence (369 amino acids)

>BWI76_RS09920 hypothetical protein (Klebsiella michiganensis M5al)
MVTLSRLFIHPVKSMRGIGLSHAYADISGLAFDRIFMVTETDGTFITARQFPQMVKFIPA
PLHDGLHLTAPDGSSAVVRFSDFSTQQEPTEVWGNHFTALIAPSAVNQWLSGFFNRNVQL
RWLGPQLSRRVQRHDAVPLSFADGFPYLLANEASLRDLQKRCPASVSIEQFRPNLLVTGA
AAWEEDTWKVVRIGEVVFDVAKPCSRCVLTTVSPERGQKHPAGEPLSTLQRFRTALDNGD
VDFGQNLIARNSGVIRVGDELEVLARGPAKAYGAGDSDDTPAPEAQQNATVEIAWQGVSF
TGNNQQILLEQLEQQGIRIPYSCRAGICGSCRIRLEEGEVSALKKNAVAADGTILCCSCV
PKTAVRLAP