Protein Info for BWI76_RS09885 in Klebsiella michiganensis M5al

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 8 to 394 (387 residues), 569.8 bits, E=1.6e-175
• PF17767: NAPRTase_N
  • amino acids 13 to 130 (118 residues), 128 bits, E=2.8e-41
• PF04095: NAPRTase
  • amino acids 169 to 394 (226 residues), 304.9 bits, E=4.8e-95

Best Hits

Swiss-Prot: 87% identical to PNCB_ESCF3: Nicotinate phosphoribosyltransferase (pncB) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_15255)

MetaCyc: 86% identical to nicotinate phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
NICOTINATEPRIBOSYLTRANS-RXN [EC: 6.3.4.21]

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD salvage pathway V (PNC V cycle) (3/5 steps found)
• NAD salvage (plants) (5/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11 or 6.3.4.21

Sequence Analysis Tools

See A0A285B1G7 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BWI76_RS09885 nicotinate phosphoribosyltransferase (Klebsiella michiganensis M5al)
MTQFTSPVLHSLLDTDAYKLHMQQAVFHRYNDVQVAAEFRCRGDDLLGIYADAIREQVET
MRDLRLQDDEYHWLSSLPFFAPDYLEWLRGFRYDPRQVTVINDNGKLNIRLSGPWLEVIM
WEVPLLAVISELVHHYRSPEISVNLALDTLEHKLTDFNRLTADIDMSGFRLMDFGTRRRF
SREVQQAIVQRLQQEPWFTGTSNYDLARRLNLTPMGTQAHEWFQAHQQISPNLASSQRAA
LAAWLEEYPDRLGIALTDCITMDAFLRDFGPEFATRYQGLRHDSGDPVEWGEKAIAHYKK
LGIDPLSKVLVFSDNLDLTKALDLYRHFSSRVNLSFGIGTRLTCDIPQVKPLNIVIKLVE
CNGKPVAKLSDSPGKTICHDKAFVRALRKAFDLPPVKKAS