Protein Info for BWI76_RS09810 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 60 PF03966: Trm112p" amino acids 2 to 41 (40 residues), 58.2 bits, see alignment E=3.1e-20

Best Hits

Swiss-Prot: 92% identical to Y919_KLEP7: UPF0434 protein KPN78578_09190 (KPN78578_09190) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K09791, hypothetical protein (inferred from 92% identity to kva:Kvar_3432)

Predicted SEED Role

"FIG002473: Protein YcaR in KDO2-Lipid A biosynthesis cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1M4 at UniProt or InterPro

Protein Sequence (60 amino acids)

>BWI76_RS09810 hypothetical protein (Klebsiella michiganensis M5al)
MDHRLLEIIACPVCNGKLYYSQDKQELICKLDRLAFPLREGIPVLLETEARPLPVEESQS