Protein Info for BWI76_RS09750 in Klebsiella michiganensis M5al

Annotation: DUF421 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details PF04239: DUF421" amino acids 97 to 166 (70 residues), 56.2 bits, see alignment E=1.3e-19

Best Hits

Swiss-Prot: 78% identical to YCAP_ECOLI: UPF0702 transmembrane protein YcaP (ycaP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to kpu:KP1_1905)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1E2 at UniProt or InterPro

Protein Sequence (230 amino acids)

>BWI76_RS09750 DUF421 domain-containing protein (Klebsiella michiganensis M5al)
MKTFDWHRMALDKVPMEFLAEVALRSLYTFVLVFIFLKITGRRGVRQMSLFEVLIILTLG
SAAGDVAFYDDVPMLPVLAVFITLALLYRLIMWLMGHSEKLEDLLEGKPIIVVENGELAW
EKLQAENMTEFEFFMELRISGVEQLGQVRLAILETNGQISLYFYEDEDVKAGLSILPSRF
TDRFTTIPRDDHYACVRCSAILTLRAGDKQLCPRCANAEWSKVSRAKRVT