Protein Info for BWI76_RS09715 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 222 to 291 (70 residues), see Phobius details amino acids 310 to 336 (27 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details PF03611: EIIC-GAT" amino acids 10 to 404 (395 residues), 390 bits, see alignment E=6.6e-121

Best Hits

KEGG orthology group: None (inferred from 97% identity to esc:Entcl_2884)

Predicted SEED Role

"FIG00513672: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1I4 at UniProt or InterPro

Protein Sequence (421 amino acids)

>BWI76_RS09715 hypothetical protein (Klebsiella michiganensis M5al)
MDFLRFIVFDILGVTPLLVGFIALIGLLIQRKPIEKVLSGTFKTIVGFLVFAGGAGLAVT
SLGNFQTLFSDGFGLKGVMPLAEALTGLAQTKFAMCVSLIMVIGFGWNLFFARVTPFKYI
FLTGQHNLYLSALLTVTLKALGYSDMTTIIVGSVLLGLAACLYPAIAQPWMRKITGNDEI
AMGHYVTLAYAASGWIGSKVGDPKQSTEKLNLPGWLGIFKDYIVSVSISVSIFYYIAALA
AGKAAVTAAAGGMHWLVYPLFQSLTFTASLYIIITGVRLLLSEIVPAFLGISEKFIPNAK
PALDCPVVFPYAPTATVLGFISSFVGGLVVMGFLAILGQTVIIPVAIPYFFIGATAAVFG
NASGGWKGAIAGSFITGILIGIGPALIYPIMESVGLSGTSFPETDFVALGLVVYYIGKML
P