Protein Info for BWI76_RS09700 in Klebsiella michiganensis M5al

Annotation: PTS IIA-like nitrogen-regulatory protein PtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF00359: PTS_EIIA_2" amino acids 11 to 143 (133 residues), 73.5 bits, see alignment E=8.8e-25

Best Hits

Swiss-Prot: 36% identical to PTMA_ECOLI: Mannitol-specific cryptic phosphotransferase enzyme IIA component (cmtB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 59% identity to esc:Entcl_2887)

MetaCyc: 36% identical to mannitol-specific PTS enzyme IIA component CmtB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-156 [EC: 2.7.1.197]

Predicted SEED Role

"Ascorbate-specific PTS system, EIIA component (EC 2.7.1.-)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 2.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.197

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1D2 at UniProt or InterPro

Protein Sequence (145 amino acids)

>BWI76_RS09700 PTS IIA-like nitrogen-regulatory protein PtsN (Klebsiella michiganensis M5al)
MEETLFSACQFTSDSLNWRSAVQLACRPLEQQGKITGSYARAIISATEQDGPWYILSPAF
ALPHARPEAGVLSRNSALSLLCCRKAVDFPQHPGIRLIVVLAAADSEQHIQTIQRLVSWL
DEEDRLRRFTEVHNQAQLEALLASH