Protein Info for BWI76_RS09665 in Klebsiella michiganensis M5al

Annotation: outer membrane lipoprotein carrier protein LolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 1 to 203 (203 residues), 386 bits, see alignment E=1.7e-120 PF03548: LolA" amino acids 33 to 191 (159 residues), 197.5 bits, see alignment E=6.5e-63

Best Hits

Swiss-Prot: 97% identical to LOLA_KLEP3: Outer-membrane lipoprotein carrier protein (lolA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 94% identity to esc:Entcl_2898)

MetaCyc: 93% identical to outer membrane lipoprotein carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1H1 at UniProt or InterPro

Protein Sequence (203 amino acids)

>BWI76_RS09665 outer membrane lipoprotein carrier protein LolA (Klebsiella michiganensis M5al)
MKKLAITCALLSSFVVSQVWADAASDLKSRLDKVSSFHSSFTQKVTDGSGNAVQDGQGDL
WVKRPNLFNWHMTQPDESVLVSDGKTLWFYNPFVEQATATWLKDATSNTPFMLIARNQAS
DWQNYNIKQNGDDFVLTPKNGSGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQN
GAVDASKFTFTPPQGVTVDDQRK